General Information

  • ID:  hor000896
  • Uniprot ID:  Q9TT95
  • Protein name:  Galanin-like peptide
  • Gene name:  GALP
  • Organism:  Sus scrofa (Pig)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042595 behavioral response to starvation; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS
  • Length:  60(23-82)
  • Propeptide:  MALTVPLIVLAVLLSLMESPASAPVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLASKRSLGETFAKPDSGVTFVGVPDVVPWKRIRPGTTRFQI
  • Signal peptide:  MALTVPLIVLAVLLSLMESPAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GALR2, GALR1
  • Target Unid:  I3LTJ3, A0A5G2R3V6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TT95-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000896_AF2.pdbhor000896_ESM.pdb

Physical Information

Mass: 725669 Formula: C281H443N81O78
Absent amino acids: CFM Common amino acids: G
pI: 10.32 Basic residues: 8
Polar residues: 20 Hydrophobic residues: 21
Hydrophobicity: -22 Boman Index: -4366
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.17
Instability Index: 5044.67 Extinction Coefficient cystines: 13980
Absorbance 280nm: 236.95

Literature

  • PubMed ID:  10601261
  • Title:  Isolation and cDNA cloning of a novel galanin-like peptide (GALP) from porcine hypothalamus.